PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00103658001
Common NameGSBRNA2T00103658001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family TALE
Protein Properties Length: 515aa    MW: 58553.8 Da    PI: 6.9164
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00103658001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox30.94.6e-103543911954
                          HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
             Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                          Fe   ++yp+++e+  LAk++gL+++qV +WF N R +
  GSBRNA2T00103658001 354 FEHflHPYPKESEKIMLAKQTGLSKNQVANWFINARVR 391
                          665559******************************88 PP

2BELL126.69e-41217288172
                 BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                          erqelq+kk+kLl++ +eVdkrY+qy++q+++v+ssFe+vaglg+akpYts+Al++iSrhFrcL+dai+eqi
  GSBRNA2T00103658001 217 ERQELQSKKNKLLTMADEVDKRYNQYYHQMEAVASSFEMVAGLGAAKPYTSVALNRISRHFRCLRDAIKEQI 288
                          79*********************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005741.9E-54146286IPR006563POX domain
PfamPF075261.2E-49152284IPR006563POX domain
PROSITE profilePS5007112.503332395IPR001356Homeobox domain
SMARTSM003896.5E-10335399IPR001356Homeobox domain
CDDcd000861.69E-11335396No hitNo description
SuperFamilySSF466897.7E-18336403IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.6E-28338401IPR009057Homeodomain-like
PfamPF059206.3E-18352391IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048510Biological Processregulation of timing of transition from vegetative to reproductive phase
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 515 aa     Download sequence    Send to blast
MAVYYPTSVG MQPLYQESIY LNEQQQASSS SAASFSGGGG GLDIPNSDGG VRNEMVFIPP  60
TNDVVVTGLN ESSSNDLSLQ GGGLSLSLGN QIQYHYQNLS NQLNYINDEN GKSLSHHHHQ  120
HQAEQVPSTG YSIGVGYYNN YRYETSGFVN SVLRSRYLKP TQQLLDEVVS VRKDMKQGES  180
NKKTKNNNND KGQDFTNGSS DNNTENKKLH EELSPQERQE LQSKKNKLLT MADEVDKRYN  240
QYYHQMEAVA SSFEMVAGLG AAKPYTSVAL NRISRHFRCL RDAIKEQIQV IRGKLGEKET  300
SEEQGERIPR LRYLDQRLRQ QRALHQQLGM VRPSWRPQRG LPENSVSILR AWLFEHFLHP  360
YPKESEKIML AKQTGLSKNQ VANWFINARV RLWKPMIEEM YKEEFGDASE LLSNSNRDKN  420
KMQETSQLKH EDSSSSQQHL QGNNNNNIAY TSAVEENLVF TDPIPDRVTT TGDYHSLMNY  480
HQGFGVDDYN RYIGLGNQQD GRFSNPHQLH DFVV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A4e-16341399563Homeobox protein Meis2
3k2a_B4e-16341399563Homeobox protein Meis2
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.66401e-171seed
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00103658001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1894930.0AC189493.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB084P16, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013592560.10.0PREDICTED: BEL1-like homeodomain protein 3
SwissprotQ9FWS90.0BLH3_ARATH; BEL1-like homeodomain protein 3
TrEMBLA0A078C8P10.0A0A078C8P1_BRANA; BnaC06g36180D protein
TrEMBLA0A0D3D0W50.0A0A0D3D0W5_BRAOL; Uncharacterized protein
STRINGBra015845.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM38201959
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75410.20.0BEL1-like homeodomain 3
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]